Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A2C057

Expression Region

1-345

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAATTCFIVAFIAAPPVD IDGIREPVAGSFMYGNNIISGAVVPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLVIFHF LIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGT FNFMFVFQAEHNILMHPFHMAGVAGMFGGALFSAMHGSLVTSSLIRETTGLDSQNYGYKF GQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLASWPVICVWLTSMGICTMAFNLNG FNFNQSVVDTSGKVVPTWGDVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 Antibody [NL-1], Mouse IgG2a
24-568 0.2 mg

CD10 Antibody [NL-1], Mouse IgG2a

Sign In for Pricing
View Details
Rabbit Polyclonal MRPL40 Antibody
NBP1-82620-25ul 25 µL

Rabbit Polyclonal MRPL40 Antibody

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-human CD49d
GT08077 25 Tests

Alexa Fluor® 647 anti-human CD49d

Sign In for Pricing
View Details
TRIX3 Antibody (N-term) Blocking Peptide
MBS9224014-01 0.5 mg

TRIX3 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
TRIX3 Antibody (N-term) Blocking Peptide
MBS9224014-02 5x 0.5 mg

TRIX3 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
1-Ethyl-3- (4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) thiourea
sc-303430A 5 g

1-Ethyl-3- (4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) thiourea

Sign In for Pricing
View Details