Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A2BP21

Expression Region

1-345

Origin

Prochlorococcus marinus (strain AS9601)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLTAAACFIVAFIAAPPVD IDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLVIFHF LIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGT FNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKF GQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVFPVVCVWLTSMGICTMAFNLNG FNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sharpin (SHARPIN) Rat ELISA Kit
H0595 96 Tests

Sharpin (SHARPIN) Rat ELISA Kit

Sign In for Pricing
View Details
Sperm Flagellar 2 Rabbit Polyclonal Antibody (Biotin)
orb460347 100 µL

Sperm Flagellar 2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal BMI-1 Antibody [DyLight 405]
NB110-40823V 0.1 mL

Rabbit Polyclonal BMI-1 Antibody [DyLight 405]

Sign In for Pricing
View Details
IL31 Chemi-Luminescent ELISA Kit (Human) (OKCD05562)
OKCD05562 96 Well

IL31 Chemi-Luminescent ELISA Kit (Human) (OKCD05562)

Sign In for Pricing
View Details
Noxa1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
32028116 3x 1.0 µg

Noxa1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
beta Catenin Polyclonal Antibody
MBS9431451-01 0.05 mL

beta Catenin Polyclonal Antibody

Sign In for Pricing
View Details