Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A2BP21

Expression Region

1-345

Origin

Prochlorococcus marinus (strain AS9601)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLTAAACFIVAFIAAPPVD IDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLVIFHF LIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGT FNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKF GQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVFPVVCVWLTSMGICTMAFNLNG FNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Jejuni fusA Protein (aa 1-691) (strain RM1221)
VAng-Ly2638-inquire Inquire

Recombinant Campylobacter Jejuni fusA Protein (aa 1-691) (strain RM1221)

Sign In for Pricing
View Details
Rabbit PTGIS (Prostaglandin I Synthase) ELISA Kit
MBS2510531-01 24 Tests

Rabbit PTGIS (Prostaglandin I Synthase) ELISA Kit

Sign In for Pricing
View Details
Rabbit PTGIS (Prostaglandin I Synthase) ELISA Kit
MBS2510531-02 48 Tests

Rabbit PTGIS (Prostaglandin I Synthase) ELISA Kit

Sign In for Pricing
View Details
Rabbit PTGIS (Prostaglandin I Synthase) ELISA Kit
MBS2510531-03 96 Tests

Rabbit PTGIS (Prostaglandin I Synthase) ELISA Kit

Sign In for Pricing
View Details
Rabbit PTGIS (Prostaglandin I Synthase) ELISA Kit
MBS2510531-04 5x 96 Tests

Rabbit PTGIS (Prostaglandin I Synthase) ELISA Kit

Sign In for Pricing
View Details
Rabbit PTGIS (Prostaglandin I Synthase) ELISA Kit
MBS2510531-05 10x 96 Tests

Rabbit PTGIS (Prostaglandin I Synthase) ELISA Kit

Sign In for Pricing
View Details