Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A3PAU3

Expression Region

1-345

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLTAAACFIVAFIAAPPVD IDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLVIFHF LIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGT FNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKF GQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVFPVVCVWLTSMGICTMAFNLNG FNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLD Polyclonal Antibody
E-AB-14947-01 20 µL

DLD Polyclonal Antibody

Sign In for Pricing
View Details
DLD Polyclonal Antibody
E-AB-14947-02 60 µL

DLD Polyclonal Antibody

Sign In for Pricing
View Details
DLD Polyclonal Antibody
E-AB-14947-03 120 µL

DLD Polyclonal Antibody

Sign In for Pricing
View Details
DLD Polyclonal Antibody
E-AB-14947-04 200 µL

DLD Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Pancreasin/Marapsin/PRSS27 Protein (His Tag)
PKSH030900 50 µg

Recombinant Human Pancreasin/Marapsin/PRSS27 Protein (His Tag)

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/837), CF405S conjugate, 0.1mg/mL
BNC040837-100 1x 100 µL

Ep-CAM / CD326 (EGP40/837), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details