Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A8G5N5

Expression Region

1-345

Origin

Prochlorococcus marinus (strain MIT 9215)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLTAAACFIVAFIAAPPVD IDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLVIFHF LIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGT FNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKF GQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVFPVVCVWLTSMGICTMAFNLNG FNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGB2 (Integrin, beta 2 (Complement Component 3 Receptor 3 and 4 Subunit), CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7) (FITC)
247760-FITC 100 µL

ITGB2 (Integrin, beta 2 (Complement Component 3 Receptor 3 and 4 Subunit), CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7) (FITC)

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike protein S2 Polyclonal Antibody
bs-24426R 100 µL

SARS-CoV-2 (2019-nCoV) Spike protein S2 Polyclonal Antibody

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF740 conjugate, 0.1mg/mL
BNC742171-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rabbit Polyclonal Glyoxalase II/HAGH Antibody
NBP1-56674 100 µL

Rabbit Polyclonal Glyoxalase II/HAGH Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TIF1 alpha Antibody (OTI2D9) - Azide and BSA Free
NBP2-74514 100 µg

Mouse Monoclonal TIF1 alpha Antibody (OTI2D9) - Azide and BSA Free

Sign In for Pricing
View Details
4-Methoxy-2-nitroaniline
281557 500 g

4-Methoxy-2-nitroaniline

Sign In for Pricing
View Details