Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A8G5N5

Expression Region

1-345

Origin

Prochlorococcus marinus (strain MIT 9215)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLTAAACFIVAFIAAPPVD IDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLVIFHF LIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGT FNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKF GQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVFPVVCVWLTSMGICTMAFNLNG FNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M-MLV Reverse Transcriptase
8006200 200 µL

M-MLV Reverse Transcriptase

Sign In for Pricing
View Details
PTRH2, NT (PTRH2, BIT1, PTH2, Peptidyl-tRNA hydrolase 2, mitochondrial, Bcl-2 inhibitor of transcription 1) (MaxLight 405)
MBS6339123-01 0.1 mL

PTRH2, NT (PTRH2, BIT1, PTH2, Peptidyl-tRNA hydrolase 2, mitochondrial, Bcl-2 inhibitor of transcription 1) (MaxLight 405)

Sign In for Pricing
View Details
PTRH2, NT (PTRH2, BIT1, PTH2, Peptidyl-tRNA hydrolase 2, mitochondrial, Bcl-2 inhibitor of transcription 1) (MaxLight 405)
MBS6339123-02 5x 0.1 mL

PTRH2, NT (PTRH2, BIT1, PTH2, Peptidyl-tRNA hydrolase 2, mitochondrial, Bcl-2 inhibitor of transcription 1) (MaxLight 405)

Sign In for Pricing
View Details
HTRA1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV668573 1.0 µg DNA

HTRA1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
MUSK rabbit pAb
UB-GEN-13564 100 µL

MUSK rabbit pAb

Sign In for Pricing
View Details
SBF2 Recombinant Protein Antigen
NBP2-13283PEP 0.1 mL

SBF2 Recombinant Protein Antigen

Sign In for Pricing
View Details