Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A8G5N5

Expression Region

1-345

Origin

Prochlorococcus marinus (strain MIT 9215)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLTAAACFIVAFIAAPPVD IDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLVIFHF LIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGT FNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKF GQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVFPVVCVWLTSMGICTMAFNLNG FNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PRKD2 (S876) Antibody
A11107-100UG 100 µg

Phospho-PRKD2 (S876) Antibody

Sign In for Pricing
View Details
Mouse Zup1 activation kit by CRISPRa
GA209282 1 Kit

Mouse Zup1 activation kit by CRISPRa

Sign In for Pricing
View Details
Methyl 8-bromo-4-hydroxyquinoline-2-carboxylate
455839-01 100 mg

Methyl 8-bromo-4-hydroxyquinoline-2-carboxylate

Sign In for Pricing
View Details
Methyl 8-bromo-4-hydroxyquinoline-2-carboxylate
455839-02 250 mg

Methyl 8-bromo-4-hydroxyquinoline-2-carboxylate

Sign In for Pricing
View Details
PHOX2B (E4Q9R) Rabbit Monoclonal Antibody
CST 27870S 100 µL

PHOX2B (E4Q9R) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ABHD1, CT (ABHD1, LABH1, Abhydrolase domain-containing protein 1, Lung alpha/beta hydrolase 1) (Biotin)
MBS6270542-01 0.2 mL

ABHD1, CT (ABHD1, LABH1, Abhydrolase domain-containing protein 1, Lung alpha/beta hydrolase 1) (Biotin)

Sign In for Pricing
View Details