Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis RDS/peripherin-like protein xRDS36 (rds36)

This Recombinant Xenopus laevis RDS/peripherin-like protein xRDS36 (rds36) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

RDS/peripherin-like protein xRDS36

UniProt

O42582

Expression Region

1-345

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLFKAKFSFQRRVKLAQTLWLLSWLSVLVGCLTFGMGIFLKVQLWIHNEVMDNTTAHAV PNTVITAGLVGILLGYFAGKISQASMDLTKYQRWKSFMMPFFFLAILSCIVCLAALVLSV ALRGTLEESLKIGLRNAIRFYKDTDTPGRCYQKRSMDKLEMDFQCCGNNHPKDWFEVQWI SNRYLDFSSKEVKDRIKSSVDGRYLMDSVPFTCCNPSSPRPCIQIEITNNSAHYSYNFQG DDVNIWVRGCREALLGYYTGIMATNGAAVTLSFLLQASVLVSLRYVQTSMDKIRDPDDVE ADTEGFLLEKGVMETVNSSLEKIKDLFKSNQVETAEGGGEGAAGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesin 5C (KIF5C) (NM_004522) Human Recombinant Protein
TP318796L 1 mg

Kinesin 5C (KIF5C) (NM_004522) Human Recombinant Protein

Sign In for Pricing
View Details
Human UNC80 Pre-designed siRNA Set A
SI017849A 1 Each

Human UNC80 Pre-designed siRNA Set A

Sign In for Pricing
View Details
HSP90AA1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
23979154 3x 1.0 µg DNA

HSP90AA1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
ATG13 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2447567 100 µL

ATG13 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Arylsulfatase F Polyclonal Antibody
UB-GEN-3644 100 µL

Arylsulfatase F Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ULK4 Antibody [FITC]
NBP2-41244F 0.1 mL

Rabbit Polyclonal ULK4 Antibody [FITC]

Sign In for Pricing
View Details