Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis RDS/peripherin-like protein xRDS36 (rds36)

This Recombinant Xenopus laevis RDS/peripherin-like protein xRDS36 (rds36) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

RDS/peripherin-like protein xRDS36

UniProt

O42582

Expression Region

1-345

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLFKAKFSFQRRVKLAQTLWLLSWLSVLVGCLTFGMGIFLKVQLWIHNEVMDNTTAHAV PNTVITAGLVGILLGYFAGKISQASMDLTKYQRWKSFMMPFFFLAILSCIVCLAALVLSV ALRGTLEESLKIGLRNAIRFYKDTDTPGRCYQKRSMDKLEMDFQCCGNNHPKDWFEVQWI SNRYLDFSSKEVKDRIKSSVDGRYLMDSVPFTCCNPSSPRPCIQIEITNNSAHYSYNFQG DDVNIWVRGCREALLGYYTGIMATNGAAVTLSFLLQASVLVSLRYVQTSMDKIRDPDDVE ADTEGFLLEKGVMETVNSSLEKIKDLFKSNQVETAEGGGEGAAGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TCTEX1D2 Antibody [Biotin]
NBP2-81831B 0.1 mL

Rabbit Polyclonal TCTEX1D2 Antibody [Biotin]

Sign In for Pricing
View Details
RGS2 Over-expression Lysate Product
GWB-7F6160 0.1 mg

RGS2 Over-expression Lysate Product

Sign In for Pricing
View Details
NTN1 Knockout KYSE150 Polyclonal Cells
ARG12316 1 Million

NTN1 Knockout KYSE150 Polyclonal Cells

Sign In for Pricing
View Details
CLGN/Calmegin Mouse mAb
E2221075 100 µL

CLGN/Calmegin Mouse mAb

Sign In for Pricing
View Details
TRIM23 Antibody
A37480-100UL 100 µL

TRIM23 Antibody

Sign In for Pricing
View Details
Mouse Oxr1/Oxidation resistance protein 1 ELISA Kit
E1088Mo 96 Tests

Mouse Oxr1/Oxidation resistance protein 1 ELISA Kit

Sign In for Pricing
View Details