Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis RDS/peripherin-like protein xRDS35 (rds35)

This Recombinant Xenopus laevis RDS/peripherin-like protein xRDS35 (rds35) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

RDS/peripherin-like protein xRDS35

UniProt

O42581

Expression Region

1-345

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLFKAKFSFQRRVKLAQTLWLLSWLSVLVGCLTFGMGIFLKVQLWIHNEVMENTSAHAV PNTVITAGLVGILLGIYAGKVSQASMDVTKYQRWKSFMMPFFFLAILSCLVCLAALVLSV ALRGTLEESLKIGLKNAIRFYKDTDTPGRCYQKRSMDKLQMDFQCCGNNHPKDWFEVQWI SNRYLDFSSKEVKDRIKSNVDGRYLMDSVPFSCCNPSSPRPCIQMQITNNSAHYSYNYQS DELNIWVRGCREALLSYYTGIMATNGAAVTLSFLLQASVLVSLRYLHTSMDKISGPDDME ADTEGFILEKGVTETMNTTLEKMKGLFMSNQVETAEGGGEAAAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NME2 Rabbit Polyclonal Antibody (HRP)
orb2576835 100 µg

NME2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Brd1 3'UTR Luciferase Stable Cell Line
TU201406 1.0 mL

Brd1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mycoplasma genitalium Uncharacterized protein MG432 (MG432), partial
MBS7080314 Inquire

Recombinant Mycoplasma genitalium Uncharacterized protein MG432 (MG432), partial

Sign In for Pricing
View Details
Guinea Pig Cystinosin (CTNS) ELISA Kit
GTR10368401 96 Well

Guinea Pig Cystinosin (CTNS) ELISA Kit

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Human APRIL / TNFSF13 (111-250) Membrane Protein, PaRoom Temperatureial, His- Flag- tag
MP0932F Each

Magic™ Antibody Discovery - Human APRIL / TNFSF13 (111-250) Membrane Protein, PaRoom Temperatureial, His- Flag- tag

Sign In for Pricing
View Details
CD34 Polyclonal Antibody, RBITC Conjugated
bs-0646R-RBITC-TR 20 µL

CD34 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details