Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein (psbA1)

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein (psbA1) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q46JV2

Expression Region

1-345

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAATTCFIVAFIAAPPVD IDGIREPVAGSFMYGNNIISGAVVPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLVIFHF LIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGT FNFMFVFQAEHNILMHPFHMAGVAGMFGGALFSAMHGSLVTSSLIRETTGLDSQNYGYKF GQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLASWPVICVWLTSMGICTMAFNLNG FNFNQSVVDTSGKVVPTWGDVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PC-PLD5 Double Nickase Plasmid (h2)
sc-414990-NIC-2 20 µg

PC-PLD5 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
PAPSS2 (PAPS Synthase 2, PAPSS 2, 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, ATPSK2, Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, Sulfurylase Kinase 2, SK 2, SK2) (MaxLight 650)
130868-ML650 100 µL

PAPSS2 (PAPS Synthase 2, PAPSS 2, 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, ATPSK2, Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, Sulfurylase Kinase 2, SK 2, SK2) (MaxLight 650)

Sign In for Pricing
View Details
Horse T-Complex Protein 1 Subunit Eta (CCT7) ELISA Kit
MBS9919002-01 48 Well

Horse T-Complex Protein 1 Subunit Eta (CCT7) ELISA Kit

Sign In for Pricing
View Details
Horse T-Complex Protein 1 Subunit Eta (CCT7) ELISA Kit
MBS9919002-02 96 Well

Horse T-Complex Protein 1 Subunit Eta (CCT7) ELISA Kit

Sign In for Pricing
View Details
Horse T-Complex Protein 1 Subunit Eta (CCT7) ELISA Kit
MBS9919002-03 5x 96 Well

Horse T-Complex Protein 1 Subunit Eta (CCT7) ELISA Kit

Sign In for Pricing
View Details
Horse T-Complex Protein 1 Subunit Eta (CCT7) ELISA Kit
MBS9919002-04 10x 96 Well

Horse T-Complex Protein 1 Subunit Eta (CCT7) ELISA Kit

Sign In for Pricing
View Details