Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein (psbA1)

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein (psbA1) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q46JV2

Expression Region

1-345

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAATTCFIVAFIAAPPVD IDGIREPVAGSFMYGNNIISGAVVPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLVIFHF LIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGT FNFMFVFQAEHNILMHPFHMAGVAGMFGGALFSAMHGSLVTSSLIRETTGLDSQNYGYKF GQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLASWPVICVWLTSMGICTMAFNLNG FNFNQSVVDTSGKVVPTWGDVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A cyclase IX (h) -PR
sc-29604-PR 10 µM - 20 µL

A cyclase IX (h) -PR

Sign In for Pricing
View Details
Cat Probable Palmitoyltransferase ZDHHC23 (ZDHHC23) ELISA Kit
MBS9939998 Inquire

Cat Probable Palmitoyltransferase ZDHHC23 (ZDHHC23) ELISA Kit

Sign In for Pricing
View Details
Human FGD1 Pre-designed siRNA Set B
SI005644B 1 Each

Human FGD1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human Pulmonary Surfactant-Associated Protein C (SFTPC) CLIA Kit
abx197616-01 96 Tests

Human Pulmonary Surfactant-Associated Protein C (SFTPC) CLIA Kit

Sign In for Pricing
View Details
Human Pulmonary Surfactant-Associated Protein C (SFTPC) CLIA Kit
abx197616-02 5x 96 Tests

Human Pulmonary Surfactant-Associated Protein C (SFTPC) CLIA Kit

Sign In for Pricing
View Details
Human Pulmonary Surfactant-Associated Protein C (SFTPC) CLIA Kit
abx197616-03 10x 96 Tests

Human Pulmonary Surfactant-Associated Protein C (SFTPC) CLIA Kit

Sign In for Pricing
View Details