Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Peripherin-2 (PRPH2)

This Recombinant Bovine Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein

UniProt

P17810

Expression Region

1-345

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFGLGLFLKIELRKRSDVMNNSESHFVP NSLIGVGVLSCVFNSLAGKICYDALDPAKYAKWKPWLKPYLAVCVLFNVVLFLVALCCFL LRGSLESTLAHGLKNGMKFYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWIS NRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPNSPRPCIQYQLTNNSAHYSYDHQTE ELNLWLRGCRAALLSYYSNLMNTTGAVTLLVWLFEVTITVGLRYLHTALEGMANPEDPEC ESEGWLLEKSVPETWKAFLESVKKLGKGNQVEAEGEDAGQAPAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR52B4 (NM_001005161) Human Over-expression Lysate
E45H03405-2 20 µg

OR52B4 (NM_001005161) Human Over-expression Lysate

Sign In for Pricing
View Details
Floor Type Low Speed Refrigerated Centrifuge BCFLR-203
BCFLR-203 1 Unit

Floor Type Low Speed Refrigerated Centrifuge BCFLR-203

Sign In for Pricing
View Details
CT45A3 Polyclonal Antibody, FITC Conjugated
bs-14092R-FITC 100 µL

CT45A3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
FAM118A (h) -PR
sc-77306-PR 10 µM - 20 µL

FAM118A (h) -PR

Sign In for Pricing
View Details
GNB1 (NM_001282539) Human Untagged Clone
SC335464 10 µg

GNB1 (NM_001282539) Human Untagged Clone

Sign In for Pricing
View Details
Horse Interleukin 1 Beta (IL1b) ELISA Kit
EKU05137 96 Tests

Horse Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details