Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Peripherin-2 (PRPH2)

This Recombinant Bovine Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein

UniProt

P17810

Expression Region

1-345

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFGLGLFLKIELRKRSDVMNNSESHFVP NSLIGVGVLSCVFNSLAGKICYDALDPAKYAKWKPWLKPYLAVCVLFNVVLFLVALCCFL LRGSLESTLAHGLKNGMKFYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWIS NRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPNSPRPCIQYQLTNNSAHYSYDHQTE ELNLWLRGCRAALLSYYSNLMNTTGAVTLLVWLFEVTITVGLRYLHTALEGMANPEDPEC ESEGWLLEKSVPETWKAFLESVKKLGKGNQVEAEGEDAGQAPAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBR4 Rabbit Polyclonal Antibody
TA383051 100 µL

UBR4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Liquid Nitrogen Containers
E1253 1 Unit

Liquid Nitrogen Containers

Sign In for Pricing
View Details
CYP2W1 Antibody / Cytochrome P450 2W1
FY13252 100 µg

CYP2W1 Antibody / Cytochrome P450 2W1

Sign In for Pricing
View Details
EphB6, NT (S45) (Ephrin Type-A Receptor 6, Tyrosine-protein Kinase Receptor EPH-6, HEP)
E3373-09F 200 µL

EphB6, NT (S45) (Ephrin Type-A Receptor 6, Tyrosine-protein Kinase Receptor EPH-6, HEP)

Sign In for Pricing
View Details
SPATA2P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV749285 1.0 µg DNA

SPATA2P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Olfactory receptor 1102, Olfr1102 ELISA KIT
ELI-13781m 96 Tests

Mouse Olfactory receptor 1102, Olfr1102 ELISA KIT

Sign In for Pricing
View Details