Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Peripherin-2 (PRPH2)

This Recombinant Bovine Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Peripherin-2, Retinal degeneration slow protein

UniProt

P17810

Expression Region

1-345

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFGLGLFLKIELRKRSDVMNNSESHFVP NSLIGVGVLSCVFNSLAGKICYDALDPAKYAKWKPWLKPYLAVCVLFNVVLFLVALCCFL LRGSLESTLAHGLKNGMKFYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWIS NRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPNSPRPCIQYQLTNNSAHYSYDHQTE ELNLWLRGCRAALLSYYSNLMNTTGAVTLLVWLFEVTITVGLRYLHTALEGMANPEDPEC ESEGWLLEKSVPETWKAFLESVKKLGKGNQVEAEGEDAGQAPAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOC3L CRISPRa sgRNA lentivector (set of three targets)(Rat)
31973126 3x 1.0µg DNA

NOC3L CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Amoxicillin Sodium 500mg
A16407-500 500 mg

Amoxicillin Sodium 500mg

Sign In for Pricing
View Details
Ubr1 (A-5) HRP
sc-515753 HRP 200 µg/mL

Ubr1 (A-5) HRP

Sign In for Pricing
View Details
RPS5 (Ribosomal Protein S5) (MaxLight 550)
251279-ML550 100 µL

RPS5 (Ribosomal Protein S5) (MaxLight 550)

Sign In for Pricing
View Details
Pig Signal transducer and activator of transcription 5A, STAT5A ELISA Kit
MBS9341630-01 48 Well

Pig Signal transducer and activator of transcription 5A, STAT5A ELISA Kit

Sign In for Pricing
View Details
Pig Signal transducer and activator of transcription 5A, STAT5A ELISA Kit
MBS9341630-02 96 Well

Pig Signal transducer and activator of transcription 5A, STAT5A ELISA Kit

Sign In for Pricing
View Details