Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Mitochondrial inner membrane magnesium transporter mrs2 (MRS2)

This Recombinant Candida glabrata Mitochondrial inner membrane magnesium transporter mrs2 (MRS2) spans the amino acid sequence from region 39-456.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane magnesium transporter mrs2, RNA-splicing protein MRS2

UniProt

Q6FV22

Expression Region

39-456

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SPQGKKTIPLLNKPESSNVGAFPSAHQQLLSLKPITPNDSFISSTVFDSKGAIVAVSKKF QKWEFLRKHALYPRDLRKIDTSSVDIIPSIQVKPNNCIVLNMLHIKALIEKDRVYVFDTV DPSSAVKLGVLMYDLESKLSPKMGTQVQYYEHRALESILINIMSSLEAEFKLHYSICGQI LIDLENEVNRDKLRELLIKSKNLTLFYQKSLLIREVLDELLESDDDLASLYLTVKKTEED DFSDLEMLLETYYTQCDEYVQQAESLIQDIKSTEEIVNIILDANRNSLMLLELKITIYTL GFTVATLVPAFYGMNLKNFIEESYLGFGAVVVFSILSAYLVTRANFKALKSVTKLTMLKS SNPSQASYNMKTNSTLRPALARIRGLFKWRKNPDSNGQPIWNKQDRDVIWKWLMDEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-500 1x 500 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF568 conjugate, 0.1mg/mL
BNC682167-500 1x 500 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF647 conjugate, 0.1mg/mL
BNC472097-100 1x 100 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details