Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vi polysaccharide export inner-membrane protein vexD (vexD)

This Recombinant Vi polysaccharide export inner-membrane protein vexD (vexD) spans the amino acid sequence from region 1-434.

Product Specifications

Product Name Alternative

Vi polysaccharide export inner-membrane protein vexD

UniProt

P43111

Expression Region

1-434

Origin

Salmonella typhi

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENSERIKKWKEERAKVAQESRASRLQQKEDERALRQTEKSADAKSHHNPDAGWSATDAD SVRRASLVIKERRVQQAKQSLRRLFLYIALPLLVIMLMSWILTSHFYSADATFIVQTDAS QDNFSGTSFFGAGNKMSEGFQVREFILSKEMMDRMEKELGFLSYFAQDDIALFSRFHAPL GINDDPYRYYLSKVSVAVDIQQGMLRLNVKARSAKQAEFFAQRILSFAEQHVNTVSARMQ KERILWLENDVKSAQENLGAARLELLKIQHIQKDIDPKETITAIYQLIAGFETQLAEAKA EYAQLMVNGLDQNPLIPRLSAKIKVLEKQIGEQRNRLSNKLGSQGSSESLSLFEDLRLQS EIAKARWESALQTLQQGKLQALRERQYLLIISQPMAESDTTRYADGTKWLLFFVLLGITY LVTSLLITIRRMRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-500 1x 500 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-500 1x 500 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details