Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Chloride intracellular channel protein 5 (CLIC5)

This Recombinant Bovine Chloride intracellular channel protein 5 (CLIC5) spans the amino acid sequence from region 1-437.

Product Specifications

Product Name Alternative

Chloride intracellular channel protein 5, Chlorine channel protein p64

UniProt

P35526

Expression Region

1-437

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDENYSTTIYNRVQTERVYEDSDPAENGGPLYDEVHEDVRREDNLYVNELENQEYDSVA VYPVGRQGRTSASLQPETGEYVLPDEPYSKAQDPHPGEPTADEDISLEELLSPTKDHQSD SEEPQASDPEEPQASDPEEPQGPDPEEPQENGNEMEADLPSPSSFTIQNSRAFSTREISP TSYSADDVSEGNESASASPEINLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVD LKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPRLAAKHRESNTAG IDIFVKFSAYIKNTKQQSNAALERGLTKALKKLDDYLNTPLPEEIDADTRGDDEKGSRRK FLDGDELTLADCNLLPKLHVVKIVAKKYRNYDFPAEMTGLWRYLKNAYARDEFTNTCAAD SEIELAYADVAKRLSRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-100 1x 100 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM1170), CF405S conjugate, 0.1mg/mL
BNC041170-100 1x 100 µL

Vimentin (VM1170), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details