Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanothece sp. Cytochrome c biogenesis protein CcsB (ccsB)

This Recombinant Cyanothece sp. Cytochrome c biogenesis protein CcsB (ccsB) spans the amino acid sequence from region 1-451.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsB

UniProt

B1WRN9

Expression Region

1-451

Origin

Cyanothece sp. (strain ATCC 51142)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTISDSPQTPENLSLPKQGFRQLIKIVADLRLAIVLLLAIALFSISGTVIEQGETISFYQ QNYPEDPALFGFLTWKVILILGLNHVYTTWWFLSLLVLFGTSLTTCTFTRQFPALKAARK WNFYQKARQFEKLALSTELAINDLKFVNNLLEQKGYKTFQENQAIYARKGIIGKIGPIVV HAAMLIILGGAIWGALTGFLAQAMVPTGSEFKVNNIIEAGPLSQPQIPKDWGIRVNRFWI DYTPDGTIDQFYSDLSVINNDGEELKHKTIYVNEPLRYHGVTFYQTDWGIAGVQAQVNNS PIFQLPMALLNTNGNGRIWGTWIPTKPDLSEGVSLLAKDLQGTMMVYDQKGDLYSAVRPG MILDINGVRLKIYQLIGSTGLQIKADPGIPFVYTGFGLLMMGVIMSYVSHSQIWVLQEDE HCYIGGKTNRSQVTFERELLGIIESLEPEKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
BNC880630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/1766R), CF568 conjugate, 0.1mg/mL
BNC681766-500 1x 500 µL

CD43 (T-Cell Marker) (SPN/1766R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF640R conjugate, 0.1mg/mL
BNC401025-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2476), CF740 conjugate, 0.1mg/mL
BNC742476-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2476), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760), CF640R conjugate, 0.1mg/mL
BNC400760-500 1x 500 µL

Cytokeratin 7 (KRT7/760), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/2877R), CF740 conjugate, 0.1mg/mL
BNC742877-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details