Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU05_0140 (ECU05_0140)

This Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU05_0140 (ECU05_0140) spans the amino acid sequence from region 1-458.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ECU05_0140

UniProt

Q8SVN2

Expression Region

1-458

Origin

Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQAISSSTLKGKVYTPIPPSESVFVYISLFLLQIFKNSRLELVLRLLKKHCIRRPIGRTC TPLSFCVPFHRQTSEKKNKRKFGIADLPLLLFQKGDRLSLHNKENLRINLAVSKFLKKYI ISQNYKYPKNPMSIMKSKIAKTLVVVVVAIAIFTLVLLMLWEGPLGTLTEENLTELNGEV PFRFKDSGSNEEGKDVTLSKFFVCLNKVLRSADDSLSSYLCCGETSEEEGESKKGKYVKN AITEARNMMFRVKDSKDVILEILKKGDKNRNELAETVSNAFSAVETSEGSDQESEGADEQ GKIEKLNTALAELYIWIWLKGIPEEDKRTLQFRKTYKENQSVKNLLDGLDEENREVAEST ILVKVGKKEDSMHVIEHILTSIFQANGYMEKGSIKQAYLSAKASVAAAGGSLGKKVSEVS DNEGKGLIDSLFGMIGWRNNSNNNSSVSKKKEEQGVNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleolar / Nucleoli (NM95), CF568 conjugate, 0.1mg/mL
BNC680095-100 1x 100 µL

Nucleolar / Nucleoli (NM95), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GABRA2 (NM_001114175) Human Over-expression Lysate
LY426471 100 µg

GABRA2 (NM_001114175) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Human Gene Knockout Kit (CRISPR)
KN209570RB 1 Kit

Cytokeratin 8 (KRT8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TAZ (WWTR1) (C-term) Rabbit Polyclonal Antibody
AP54578PU-N 400 µL

TAZ (WWTR1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/834), CF640R conjugate, 0.1mg/mL
BNC400834-500 1x 500 µL

Cytokeratin 18 (KRT18/834), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-B Griffonia simplicifolia Lectin -GSI-
B-2401-2 2 mL

Anti-B Griffonia simplicifolia Lectin -GSI-

Sign In for Pricing
View Details