Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU05_0140 (ECU05_0140)

This Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU05_0140 (ECU05_0140) spans the amino acid sequence from region 1-458.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ECU05_0140

UniProt

Q8SVN2

Expression Region

1-458

Origin

Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQAISSSTLKGKVYTPIPPSESVFVYISLFLLQIFKNSRLELVLRLLKKHCIRRPIGRTC TPLSFCVPFHRQTSEKKNKRKFGIADLPLLLFQKGDRLSLHNKENLRINLAVSKFLKKYI ISQNYKYPKNPMSIMKSKIAKTLVVVVVAIAIFTLVLLMLWEGPLGTLTEENLTELNGEV PFRFKDSGSNEEGKDVTLSKFFVCLNKVLRSADDSLSSYLCCGETSEEEGESKKGKYVKN AITEARNMMFRVKDSKDVILEILKKGDKNRNELAETVSNAFSAVETSEGSDQESEGADEQ GKIEKLNTALAELYIWIWLKGIPEEDKRTLQFRKTYKENQSVKNLLDGLDEENREVAEST ILVKVGKKEDSMHVIEHILTSIFQANGYMEKGSIKQAYLSAKASVAAAGGSLGKKVSEVS DNEGKGLIDSLFGMIGWRNNSNNNSSVSKKKEEQGVNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gphb5 (NM_001007013) Rat Tagged ORF Clone
RR201358 10 µg

Gphb5 (NM_001007013) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Pelodictyon phaeoclathratiforme 3-dehydroquinate dehydratase (aroQ)
MBS1007061-01 0.02 mg (E-Coli)

Recombinant Pelodictyon phaeoclathratiforme 3-dehydroquinate dehydratase (aroQ)

Sign In for Pricing
View Details
Recombinant Pelodictyon phaeoclathratiforme 3-dehydroquinate dehydratase (aroQ)
MBS1007061-02 0.1 mg (E-Coli)

Recombinant Pelodictyon phaeoclathratiforme 3-dehydroquinate dehydratase (aroQ)

Sign In for Pricing
View Details
Recombinant Pelodictyon phaeoclathratiforme 3-dehydroquinate dehydratase (aroQ)
MBS1007061-03 0.02 mg (Yeast)

Recombinant Pelodictyon phaeoclathratiforme 3-dehydroquinate dehydratase (aroQ)

Sign In for Pricing
View Details
Recombinant Pelodictyon phaeoclathratiforme 3-dehydroquinate dehydratase (aroQ)
MBS1007061-04 0.1 mg (Yeast)

Recombinant Pelodictyon phaeoclathratiforme 3-dehydroquinate dehydratase (aroQ)

Sign In for Pricing
View Details
Recombinant Pelodictyon phaeoclathratiforme 3-dehydroquinate dehydratase (aroQ)
MBS1007061-05 0.02 mg (Baculovirus)

Recombinant Pelodictyon phaeoclathratiforme 3-dehydroquinate dehydratase (aroQ)

Sign In for Pricing
View Details