Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Uncharacterized protein At5g49945 (At5g49945)

This Recombinant Arabidopsis thaliana Uncharacterized protein At5g49945 (At5g49945) spans the amino acid sequence from region 22-480.

Product Specifications

Product Name Alternative

Uncharacterized protein At5g49945

UniProt

Q94CC0

Expression Region

22-480

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SPFEGFDAEEDDVTDDSSHLLHHSLPPPLLTQSHSSLSDPDPEPEPSSAECKSDLITESD LEHQSDSKTPSSTPFEYWDEDEFEGLPVEIETLESPLITENGTHADPKTPDLKTSSEAQG DTNDQTKKKKSYAVEIACVCFLIALAINYFVGKRENESLALAWAAKFASKDTIFQKNFSM LGVSELEDSPLLLKEALNVFKFYASGRRYCHGLLATMELKSRHDLISRVFNLVVPCKDEI TFEVYMNEETMDHVVFAMTKKKAAKTMQKEMRDLQRFAGIVSPPAGRKWVSEEFALISES KEVAADLITDTVLDQVFGDKAVDKYGKNFMSMHISDQHPGKHKKMMLFKFSLPDAKHMDD IVRLVALIPYYIDLVGRYRLSSQARNKTESGRQKAAEEAYKELHNARQEALQKKKAEKKK MMEEAEAKMSAEVIRKKEAKERARQVKKAVPKMKMSRSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-100 1x 100 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-500 1x 500 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF594 conjugate, 0.1mg/mL
BNC942746-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details