Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sterol regulatory element-binding protein 2 (Srebf2)

This Recombinant Mouse Sterol regulatory element-binding protein 2 (Srebf2) spans the amino acid sequence from region 1-473.

Product Specifications

Product Name Alternative

Sterol regulatory element-binding protein 2, SREBP-2, Sterol regulatory element-binding transcription factor 2, Cleaved into the following chain:, 1. Processed sterol regulatory element-bin

UniProt

Q3U1N2

Expression Region

1-473

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDESSELGVLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGGGSN GGSGNNSSGRGNNGGATDPAVQRSFSQVPLSTFSPSAASPQAPALQVKVSPTPPRATPVL QPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTS PQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTD SLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAALQVPTLVGSNGTILTTMPVMMGQEKV PIKQVPGGVKQLDPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSGVLR KAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIDDFNQNVLLM SPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metribuzin DADK
TRC-M339085-500MG 500 mg

Metribuzin DADK

Sign In for Pricing
View Details
ALG1 (NM_019109) Human Over-expression Lysate
LY402736 100 µg

ALG1 (NM_019109) Human Over-expression Lysate

Sign In for Pricing
View Details
Amplite® Fluorimetric Endotoxin Detection Kit
60006-AAT 100 Tests

Amplite® Fluorimetric Endotoxin Detection Kit

Sign In for Pricing
View Details
B7-H4 (VTCN1) Rabbit Polyclonal Antibody
ER1802-56 100 µL

B7-H4 (VTCN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Topoisomerase II alpha (TOP2A) Human Gene Knockout Kit (CRISPR)
KN421568 1 Kit

Topoisomerase II alpha (TOP2A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTA3 Mouse Monoclonal Antibody [Clone ID: OTI2B8]
CF809742 100 µg

MTA3 Mouse Monoclonal Antibody [Clone ID: OTI2B8]

Sign In for Pricing
View Details