Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sterol regulatory element-binding protein 2 (Srebf2)

This Recombinant Mouse Sterol regulatory element-binding protein 2 (Srebf2) spans the amino acid sequence from region 1-473.

Product Specifications

Product Name Alternative

Sterol regulatory element-binding protein 2, SREBP-2, Sterol regulatory element-binding transcription factor 2, Cleaved into the following chain:, 1. Processed sterol regulatory element-bin

UniProt

Q3U1N2

Expression Region

1-473

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDESSELGVLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGGGSN GGSGNNSSGRGNNGGATDPAVQRSFSQVPLSTFSPSAASPQAPALQVKVSPTPPRATPVL QPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTS PQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTD SLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAALQVPTLVGSNGTILTTMPVMMGQEKV PIKQVPGGVKQLDPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSGVLR KAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIDDFNQNVLLM SPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ornithine Decarboxylase-1 (ODC-1) (ODC1/3636R), CF640R conjugate, 0.1mg/mL
BNC403636-100 1x 100 µL

Ornithine Decarboxylase-1 (ODC-1) (ODC1/3636R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ɑ-Butyric Acid NHS Ester-ω-Fmoc Amino PEG
133000-22-35.500MG 500 mg

Ɑ-Butyric Acid NHS Ester-ω-Fmoc Amino PEG

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1799R), CF740 conjugate, 0.1mg/mL
BNC741799-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1799R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS713926 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Recombinant Human KIR2DL3/NKAT2 Protein (Fc Tag)
PKSH032674-01 10 µg

Recombinant Human KIR2DL3/NKAT2 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human KIR2DL3/NKAT2 Protein (Fc Tag)
PKSH032674-02 50 µg

Recombinant Human KIR2DL3/NKAT2 Protein (Fc Tag)

Sign In for Pricing
View Details