Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane and coiled-coil domains protein 3 (Tmcc3)

This Recombinant Mouse Transmembrane and coiled-coil domains protein 3 (Tmcc3) spans the amino acid sequence from region 1-477.

Product Specifications

Product Name Alternative

Transmembrane and coiled-coil domains protein 3

UniProt

Q8R310

Expression Region

1-477

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGSDTALTVDRTYSDPGRHHRCKSRVDRHDMNTLSLPLNIRRGGSDTNLNFDVPDGILD FHKVKLNADSLRQKILKVTEQIKIEQTSRDGNVAEYLKLVSSADKQQAGRIKQVFEKKNQ KSAHSIAQLQKKLEQYHRKLREIEQNGVTRSSKDISKDSLKEIHHSLKDAHVKSRTAPHC LESSKSSMPGVSLTPPVFVFNKSREFANLIRNKFGSADNIAHLKNSLEEFRPEASPRAYG GSATIVNKPKYGSDDECSSGTSGSADSNGNQSFGAGGTSTLDSQGKIAKIMEELREIKVT QTQLAEDIEALKVQFKREYGFISQTLQEERYRYERLEDQLHDLTELHQHETANLKQELAS AEEKVAYQAYERSRDIQEALESCQTRISKLELHQQEQQTLQTDAVNAKVLLGKCINVVLA FMTVILVCVSTLAKFVSPMMKSRSHILGTFFAVTLLAIFCKNWDHILCAIERIIIPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-500 1x 500 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-500 1x 500 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), CF740 conjugate, 0.1mg/mL
BNC742174-100 1x 100 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF594 conjugate, 0.1mg/mL
BNC942152-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-500 1x 500 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details