Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas entomophila Cardiolipin synthase (cls)

This Recombinant Pseudomonas entomophila Cardiolipin synthase (cls) spans the amino acid sequence from region 1-479.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

Q1I2L0

Expression Region

1-479

Origin

Pseudomonas entomophila (strain L48)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYHSPYFFGYLIGLIHLLGIIAALHAVFTVRTAQGAIAWALSLLFIPYFTLIPYLIFGA RSFYAYIQARRQANQEMHVAMANLNWRPWVEEALTARESDSYAALRAMPKLGRMPCLANN EVKLLIDGEATFKAIFAAIEAARNTVLVQFFIIHDDTLGKQLQRLLLRKAAEGVQVFVLY DRVGSHALPGSYSQVLRDGGVQIQAFATRRGWFNRFQVNFRNHRKIVVVDGLRGFLGGHN VGDEYLGANPHLSPWRDTHVQIAGPVLACLQESFAEDWYWATRQLPPLILPDTYPENGVL CQALASGPADPQETCALFFLEAIHSATRRVWITSPYFIPDEAIFAALRLAVLRGVDVRVL IPSRPDHRIVYAASSLFAFEAVRAGVRMFRYQPGFLHQKVVLVDDEVSAIGSANLDNRSF RLNFEITLLTVDRAFADQVEQMLQSDFDQAREITAEDSRDTHRLQQLGMRIARLISPIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-500 1x 500 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details