Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ESX-1 secretion system protein eccB1 (eccB1)

This Recombinant ESX-1 secretion system protein eccB1 (eccB1) spans the amino acid sequence from region 1-480.

Product Specifications

Product Name Alternative

ESX-1 secretion system protein eccB1, ESX conserved component B1, Type VII secretion system protein eccB1, T7SS protein eccB1

UniProt

O69734

Expression Region

1-480

Origin

Mycobacterium tuberculosis

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLRLTTKVQVSGWRFLLRRLEHAIVRRDTRMFDDPLQFYSRSIALGIVVAVLILAGAAL LAYFKPQGKLGGTSLFTDRATNQLYVLLSGQLHPVYNLTSARLVLGNPANPATVKSSELS KLPMGQTVGIPGAPYATPVSAGSTSIWTLCDTVARADSTSPVVQTAVIAMPLEIDASIDP LQSHEAVLVSYQGETWIVTTKGRHAIDLTDRALTSSMGIPVTARPTPISEGMFNALPDMG PWQLPPIPAAGAPNSLGLPDDLVIGSVFQIHTDKGPQYYVVLPDGIAQVNATTAAALRAT QAHGLVAPPAMVPSLVVRIAERVYPSPLPDEPLKIVSRPQDPALCWSWQRSAGDQSPQST VLSGRHLPISPSAMNMGIKQIHGTATVYLDGGKFVALQSPDPRYTESMYYIDPQGVRYGV PNAETAKSLGLSSPQNAPWEIVRLLVDGPVLSKDAALLEHDTLPADPSPRKVPAGASGAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ataxin 2 ATXN2 ELISA Kit
BG-RAT10054 1 Each

Rat Ataxin 2 ATXN2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Bacillus cereus UPF0295 protein BCE_0593 (BCE_0593)
MBS7036598-01 0.02 mg

Recombinant Bacillus cereus UPF0295 protein BCE_0593 (BCE_0593)

Sign In for Pricing
View Details
Recombinant Bacillus cereus UPF0295 protein BCE_0593 (BCE_0593)
MBS7036598-02 0.1 mg

Recombinant Bacillus cereus UPF0295 protein BCE_0593 (BCE_0593)

Sign In for Pricing
View Details
Recombinant Bacillus cereus UPF0295 protein BCE_0593 (BCE_0593)
MBS7036598-03 5x 0.1 mg

Recombinant Bacillus cereus UPF0295 protein BCE_0593 (BCE_0593)

Sign In for Pricing
View Details
Anti-SerpinB1 Rabbit Polyclonal Antibody
orb2568875 100 µg

Anti-SerpinB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SFXN3 Rabbit Polyclonal Antibody (AP)
orb949417 100 µL

SFXN3 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details