Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ESX-1 secretion system protein eccB1 (eccB1)

This Recombinant ESX-1 secretion system protein eccB1 (eccB1) spans the amino acid sequence from region 1-480.

Product Specifications

Product Name Alternative

ESX-1 secretion system protein eccB1, ESX conserved component B1, Type VII secretion system protein eccB1, T7SS protein eccB1

UniProt

O69734

Expression Region

1-480

Origin

Mycobacterium tuberculosis

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLRLTTKVQVSGWRFLLRRLEHAIVRRDTRMFDDPLQFYSRSIALGIVVAVLILAGAAL LAYFKPQGKLGGTSLFTDRATNQLYVLLSGQLHPVYNLTSARLVLGNPANPATVKSSELS KLPMGQTVGIPGAPYATPVSAGSTSIWTLCDTVARADSTSPVVQTAVIAMPLEIDASIDP LQSHEAVLVSYQGETWIVTTKGRHAIDLTDRALTSSMGIPVTARPTPISEGMFNALPDMG PWQLPPIPAAGAPNSLGLPDDLVIGSVFQIHTDKGPQYYVVLPDGIAQVNATTAAALRAT QAHGLVAPPAMVPSLVVRIAERVYPSPLPDEPLKIVSRPQDPALCWSWQRSAGDQSPQST VLSGRHLPISPSAMNMGIKQIHGTATVYLDGGKFVALQSPDPRYTESMYYIDPQGVRYGV PNAETAKSLGLSSPQNAPWEIVRLLVDGPVLSKDAALLEHDTLPADPSPRKVPAGASGAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human POLD4 Polyclonal Antibody
HD558014-01 50 µg

Anti-Human POLD4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human POLD4 Polyclonal Antibody
HD558014-02 100 µg

Anti-Human POLD4 Polyclonal Antibody

Sign In for Pricing
View Details
Rno-miR-20b-5p miRNA Antagomir
CIS0223-01 10 nmol

Rno-miR-20b-5p miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-20b-5p miRNA Antagomir
CIS0223-02 20 nmol

Rno-miR-20b-5p miRNA Antagomir

Sign In for Pricing
View Details
Rat growth differentiation factot 8 (GDF8) ELISA Kit
YP-W34915-01 48 Tests

Rat growth differentiation factot 8 (GDF8) ELISA Kit

Sign In for Pricing
View Details
Rat growth differentiation factot 8 (GDF8) ELISA Kit
YP-W34915-02 96 Tests

Rat growth differentiation factot 8 (GDF8) ELISA Kit

Sign In for Pricing
View Details