Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans Cardiolipin synthase (cls)

This Recombinant Bacillus halodurans Cardiolipin synthase (cls) spans the amino acid sequence from region 1-503.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CL synthase, EC= 2.7.8.-

UniProt

Q9K8Z4

Expression Region

1-503

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNRLNVLLFLLILSTGLYLTRSFWQGWIVGAFSVLITITVVFIGIVIFLENRHPTKTLT WLMVLAVFPVVGFIFYLMFGQNHRKSKTFMKKALSDEEAFEKIEGNRQLNEEQLQKMGGH QQLLFRLAHRLANNPISFSTNTKVLTDGKETFAHIKQALRMATHHIHLEYYIVRDDEIGQ EIKEILMQKAKEGIHVRFLYDGVGSWKLSKSYIQDLKQAGVEIVPFAPVKLPFINHTINY RNHRKIIVIDGTVGFVGGLNIGDEYLGKDPYFGFWRDTHLYVRGEAVRTLQLIFLRDWAH ETGETILKPSYLSPALTNMKDDGGVQMIASGPDTRWEINKKLFFSMITSAKKSIWITSPY FIPDEDILSALKIAALSGIDVRILVPNRPDKRIVFHASRSYFPELLEAGVKVYEYTRGFL HSKIIIVDNEIASIGTSNMDMRSFHLNFEVNAFLYRTKSVTTLVSDFVYDLEHTNQIRFE QFRNRAWYYRVLESTCRLLSPLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF647 conjugate, 0.1mg/mL
BNC470820-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF568 conjugate, 0.1mg/mL
BNC682946-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF568 conjugate, 0.1mg/mL
BNC680018-500 1x 500 µL

Human Kappa Light Chain (L1C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details