Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 (Lrit2)

This Recombinant Mouse Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 (Lrit2) spans the amino acid sequence from region 23-549.

Product Specifications

Product Name Alternative

Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2, Leucine-rich repeat-containing protein 22

UniProt

Q6PFC5

Expression Region

23-549

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FCLPECTCSEESFGRSLQCMSMSLGKIPDNFPEELKQVRIENSPLFELSQGFFTNMSSLE YLWLNFNNVTVIHLGALEDLPELRELRLEGNKLRSVPWTAFRATPLLRVLDLKHNRIDSV PELALQFLTNLIYLDISSNRLTVVSKGVFLNWPAYQKRQQLGCGAEFLSNMVLSLHNNPW LCDCRLRGLAQFVKSVGPPFILVNSYLVCQGPVSKAGQLLHETELGVCMKPTISTPSVNV TIQVGKNVTLQCFAQASPSPTIAWKYPLSTWREFDVLASPIAEGIILSQLVIPAAQLVDG GNYTCMAFNSIGRSSLVILLYVQPAQAMPGLHFLSTSSEVSAYVDLRVVKQTVHGILLQW LTVTNLAEEQWFTLYITSDEALRKKVVHIGPGINTYAVDDLLPATKYKACLSLRNQPPSQ GQCVVFVTGKDSGGLEGREHLLHVTVVLCAVLLALPVGAYVWVSQGPYNFSEWCWRRCPL HRKTLRCPQAVPQCKDNSFKDPSGVYEDGESHRVMEEDEEVEKEGIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14/532), CF488A conjugate, 0.1mg/mL
BNC880532-500 1x 500 µL

Cytokeratin 14 (KRT14/532), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL
BNC470800-100 1x 100 µL

Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/835), CF647 conjugate, 0.1mg/mL
BNC470835-100 1x 100 µL

Cytokeratin 18 (KRT18/835), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details