Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yvdR (yvdR)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yvdR (yvdR) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yvdR

UniProt

O06999

Expression Region

1-106

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWFLLVIAGIEEIIAAIAMKYIDGTRKKWPIIVMTVGFGLSFYCLSQAMIVLPAGVAYA VWTGIGSIGVSAVGLIWFKERFQLSQVISLCLILAGVIGLRLTSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS35 Rabbit Monoclonal Antibody [Clone ID: 23GB4260]
TA425337 100 µL

VPS35 Rabbit Monoclonal Antibody [Clone ID: 23GB4260]

Sign In for Pricing
View Details
CCBP2 Antibody
8G066-AAT 50 µg

CCBP2 Antibody

Sign In for Pricing
View Details
Dibenzyl Azodicarboxylate
TRC-D417215-5G 5 g

Dibenzyl Azodicarboxylate

Sign In for Pricing
View Details
Carboxy Polystyrene
H10008.5G 5 g

Carboxy Polystyrene

Sign In for Pricing
View Details
COL1A1 Polyclonal Antibody
E-AB-40665-01 25 µL

COL1A1 Polyclonal Antibody

Sign In for Pricing
View Details
COL1A1 Polyclonal Antibody
E-AB-40665-02 100 µL

COL1A1 Polyclonal Antibody

Sign In for Pricing
View Details