Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yvdR (yvdR)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yvdR (yvdR) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yvdR

UniProt

O06999

Expression Region

1-106

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWFLLVIAGIEEIIAAIAMKYIDGTRKKWPIIVMTVGFGLSFYCLSQAMIVLPAGVAYA VWTGIGSIGVSAVGLIWFKERFQLSQVISLCLILAGVIGLRLTSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIPK4 Polyclonal Antibody
E-AB-14679-01 20 µL

HIPK4 Polyclonal Antibody

Sign In for Pricing
View Details
HIPK4 Polyclonal Antibody
E-AB-14679-02 60 µL

HIPK4 Polyclonal Antibody

Sign In for Pricing
View Details
HIPK4 Polyclonal Antibody
E-AB-14679-03 120 µL

HIPK4 Polyclonal Antibody

Sign In for Pricing
View Details
HIPK4 Polyclonal Antibody
E-AB-14679-04 200 µL

HIPK4 Polyclonal Antibody

Sign In for Pricing
View Details
CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: 123C3.D5 + 123A8]
AM50240PU-T 20 µg

CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: 123C3.D5 + 123A8]

Sign In for Pricing
View Details
ECRG4 Antibody
8C11679-AAT 50 µg

ECRG4 Antibody

Sign In for Pricing
View Details