Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yvdR (yvdR)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yvdR (yvdR) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yvdR

UniProt

O06999

Expression Region

1-106

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWFLLVIAGIEEIIAAIAMKYIDGTRKKWPIIVMTVGFGLSFYCLSQAMIVLPAGVAYA VWTGIGSIGVSAVGLIWFKERFQLSQVISLCLILAGVIGLRLTSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Quinuclidinone Hydrochloride
TRC-Q795795-10G 10 g

3-Quinuclidinone Hydrochloride

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD564686 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
Tnnt2 (NM_001130179) Mouse Recombinant Protein
TP523331 20 µg

Tnnt2 (NM_001130179) Mouse Recombinant Protein

Sign In for Pricing
View Details
3,5-Di-O-benzyl Phloroglucin Glucuronide Sodium Salt
TRC-D417875-2.5MG 2.5 mg

3,5-Di-O-benzyl Phloroglucin Glucuronide Sodium Salt

Sign In for Pricing
View Details
beta Catenin (CTNNB1) (327-331) Rabbit Polyclonal Antibody
AP26073PU-N 100 µL

beta Catenin (CTNNB1) (327-331) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spastin (Sp 6C6), CF405S conjugate, 0.1mg/mL
BNC043070-500 1x 500 µL

Spastin (Sp 6C6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details