Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus sp. Quaternary ammonium compound-resistance protein qacG (qacG)

This Recombinant Staphylococcus sp. Quaternary ammonium compound-resistance protein qacG (qacG) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Quaternary ammonium compound-resistance protein qacG, Quaternary ammonium determinant G

UniProt

O87866

Expression Region

1-107

Origin

Staphylococcus sp. (strain ST94)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHYLYLFISIATEIIGTSFLKTSEGFTKLWPTLGTLLSFGICFYFLSLTIKFLPLNITYA TWAGLGLVLTTIISVIVFKENVNLISIISIGLIVIGVVLLNVFGESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF640R conjugate, 0.1mg/mL
BNC401893-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF568 conjugate, 0.1mg/mL
BNC682266-500 1x 500 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details