Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0060 membrane protein ynfA (ynfA)

This Recombinant UPF0060 membrane protein ynfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein ynfA

UniProt

A1ABC7

Expression Region

1-108

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALIWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gas1 activation kit by CRISPRa
GA201546 1 Kit

Mouse Gas1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse 1810055G02Rik activation kit by CRISPRa
GA209080 1 Kit

Mouse 1810055G02Rik activation kit by CRISPRa

Sign In for Pricing
View Details
NRF1 (NRF1/2608), CF488A conjugate, 0.1mg/mL
BNC882608-100 1x 100 µL

NRF1 (NRF1/2608), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
mCherry Goat Polyclonal Antibody
AB0081-500 1.5 mg

mCherry Goat Polyclonal Antibody

Sign In for Pricing
View Details
Mitofusin 1 (MFN1) Rabbit Polyclonal Antibody
TA378496 100 µL

Mitofusin 1 (MFN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRFAP1L1 (Center) Rabbit Polyclonal Antibody
AP52745PU-N 400 µL

MRFAP1L1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details