Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0060 membrane protein ynfA (ynfA)

This Recombinant UPF0060 membrane protein ynfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein ynfA

UniProt

A1ABC7

Expression Region

1-108

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALIWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS803315 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
TOX2 (NM_001098796) Human Recombinant Protein
TP311560M 100 µg

TOX2 (NM_001098796) Human Recombinant Protein

Sign In for Pricing
View Details
DNAJA1 Recombinant Rabbit Monoclonal Antibody [JE40-13]
HA722276 100 µL

DNAJA1 Recombinant Rabbit Monoclonal Antibody [JE40-13]

Sign In for Pricing
View Details
Recombinant Human Renin/REN protein (His tag)
PDMH100101-01 20 µg

Recombinant Human Renin/REN protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Renin/REN protein (His tag)
PDMH100101-02 100 µg

Recombinant Human Renin/REN protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Renin/REN protein (His tag)
PDMH100101-03 500 µg

Recombinant Human Renin/REN protein (His tag)

Sign In for Pricing
View Details