Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

A1ABE4

Expression Region

1-109

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SerRS (m) -PR
sc-76481-PR 10 µM - 20 µL

SerRS (m) -PR

Sign In for Pricing
View Details
Human RIIAD1 qPCR Primer Pair
QH71469S 200 Tests

Human RIIAD1 qPCR Primer Pair

Sign In for Pricing
View Details
Bombesin Receptor 2 Antibody
A43196-50UG 50 µg

Bombesin Receptor 2 Antibody

Sign In for Pricing
View Details
ZNF853 sgRNA CRISPR Lentivector set (Human)
K2738201 3x 1.0 µg

ZNF853 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
TBC1D8, CT (TBC1D8, VRP, TBC1 domain family member 8, AD 3, Vascular Rab-GAP/TBC-containing protein) (PE) discontinued
042642-PE 200 µL

TBC1D8, CT (TBC1D8, VRP, TBC1 domain family member 8, AD 3, Vascular Rab-GAP/TBC-containing protein) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Human Bis (5'-adenosyl)-triphosphatase (FHIT)
MBS952600-01 0.02 mg (E-Coli)

Recombinant Human Bis (5'-adenosyl)-triphosphatase (FHIT)

Sign In for Pricing
View Details