Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

A1ABE4

Expression Region

1-109

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm10831 3'UTR GFP Stable Cell Line
TU157369 1.0 mL

Gm10831 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
2-Fluoro-5-hydroxybenzoic acid
PC9534-01 1 g

2-Fluoro-5-hydroxybenzoic acid

Sign In for Pricing
View Details
2-Fluoro-5-hydroxybenzoic acid
PC9534-02 5 g

2-Fluoro-5-hydroxybenzoic acid

Sign In for Pricing
View Details
2-Fluoro-5-hydroxybenzoic acid
PC9534-03 10 g

2-Fluoro-5-hydroxybenzoic acid

Sign In for Pricing
View Details
hsa-miR-4310 miRNA Antagomir
MNH02258 2x 5.0 nmol

hsa-miR-4310 miRNA Antagomir

Sign In for Pricing
View Details
Rabbit Monoclonal S100A1 Antibody (004) [mFluor Violet 500 SE]
NBP2-90503MFV500 0.1 mL

Rabbit Monoclonal S100A1 Antibody (004) [mFluor Violet 500 SE]

Sign In for Pricing
View Details