Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Protein mistic (mstX)

This Recombinant Bacillus subtilis Protein mistic (mstX) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Protein mistic, Membrane-integrating protein mstX

UniProt

Q5BU39

Expression Region

1-110

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFCTFFEKHHRKWDILLEKSTGVMEAMKVTSEEKEQLSTAIDRMNEGLDAFIQLYNESEI DEPLIQLDDDTAELMKQARDMYGQEKLNEKLNTIIKQILSISVSEEGEKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42EP2 (NM_006779) Human Untagged Clone
SC115843 10 µg

CDC42EP2 (NM_006779) Human Untagged Clone

Sign In for Pricing
View Details
Methyl 3-amino-5-methoxyisonicotinate
OR1069701-01 100 mg

Methyl 3-amino-5-methoxyisonicotinate

Sign In for Pricing
View Details
Methyl 3-amino-5-methoxyisonicotinate
OR1069701-02 250 mg

Methyl 3-amino-5-methoxyisonicotinate

Sign In for Pricing
View Details
Methyl 3-amino-5-methoxyisonicotinate
OR1069701-03 1 g

Methyl 3-amino-5-methoxyisonicotinate

Sign In for Pricing
View Details
Methyl 3-amino-5-methoxyisonicotinate
OR1069701-04 5 g

Methyl 3-amino-5-methoxyisonicotinate

Sign In for Pricing
View Details
Rat E3 ubiquitin-protein ligase RNF187, RNF187 ELISA Kit
MBS9338412-01 48 Well

Rat E3 ubiquitin-protein ligase RNF187, RNF187 ELISA Kit

Sign In for Pricing
View Details