Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Protein mistic (mstX)

This Recombinant Bacillus subtilis Protein mistic (mstX) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Protein mistic, Membrane-integrating protein mstX

UniProt

Q5BU39

Expression Region

1-110

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFCTFFEKHHRKWDILLEKSTGVMEAMKVTSEEKEQLSTAIDRMNEGLDAFIQLYNESEI DEPLIQLDDDTAELMKQARDMYGQEKLNEKLNTIIKQILSISVSEEGEKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T7 Endonuclease I
RK20541 1250 U

T7 Endonuclease I

Sign In for Pricing
View Details
MC38/Human CD39 stable Cell Line
CSB-SC007690HU1-E 1 Vial - 5x 10^6 Cells in 1 mL

MC38/Human CD39 stable Cell Line

Sign In for Pricing
View Details
Human FEN1 activation kit by CRISPRa
GA101562 1 Kit

Human FEN1 activation kit by CRISPRa

Sign In for Pricing
View Details
UBE2D1 shRNA (m) Lentiviral Particles
sc-41680-V 200 µL

UBE2D1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Laminin Beta 2 (LAMb2) Polyclonal Antibody
CAU24732-01 100 µL

Laminin Beta 2 (LAMb2) Polyclonal Antibody

Sign In for Pricing
View Details
Laminin Beta 2 (LAMb2) Polyclonal Antibody
CAU24732-02 200 µL

Laminin Beta 2 (LAMb2) Polyclonal Antibody

Sign In for Pricing
View Details