Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium sp. UPF0060 membrane protein Mmcs_2513 (Mmcs_2513)

This Recombinant Mycobacterium sp. UPF0060 membrane protein Mmcs_2513 (Mmcs_2513) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

UPF0060 membrane protein Mmcs_2513

UniProt

Q1B913

Expression Region

1-113

Origin

Mycobacterium sp. (strain MCS)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTGVLVLKSAALFVLAALLEIGGAWLVWQGVREHRGWIWAGAGVIALGAYGFVAAFQPD AHFGRILAAYGGVFVAGSLLWGVVVDGFRPDRWDLTGALVCLVGVGLIMYAPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-100 1x 100 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF568 conjugate, 0.1mg/mL
BNC682406-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details