Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative ethidium bromide resistance protein (ebr)

This Recombinant Putative ethidium bromide resistance protein (ebr) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Putative ethidium bromide resistance protein, E1 protein

UniProt

P0AA22

Expression Region

1-115

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse UMPS shRNA Plasmid
abx973314-01 150 µg

Mouse UMPS shRNA Plasmid

Sign In for Pricing
View Details
Mouse UMPS shRNA Plasmid
abx973314-02 300 µg

Mouse UMPS shRNA Plasmid

Sign In for Pricing
View Details
ZNF26 Human shRNA Lentiviral Particle (Locus ID 7574)
TL300272V 500 µL Each

ZNF26 Human shRNA Lentiviral Particle (Locus ID 7574)

Sign In for Pricing
View Details
SLC32A1 antibody
70R-20343 50 μL

SLC32A1 antibody

Sign In for Pricing
View Details
VEGFA Protein Vector (Mouse) (pPB-N-His)
PV244987 500 ng

VEGFA Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Coagulation Factor VII (F7)
MBS2060142-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Coagulation Factor VII (F7)

Sign In for Pricing
View Details