Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative ethidium bromide resistance protein (ebr)

This Recombinant Putative ethidium bromide resistance protein (ebr) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Putative ethidium bromide resistance protein, E1 protein

UniProt

P0AA22

Expression Region

1-115

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99L2 Antibody, HRP conjugated
A63452-100UG 100 µg

CD99L2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Complexin 3
311724 100 µL

Complexin 3

Sign In for Pricing
View Details
Butyric-2,2-d2 Acid
TRC-B692236-100MG 100 mg

Butyric-2,2-d2 Acid

Sign In for Pricing
View Details
ECHDC1, CT (ECHDC1, Ethylmalonyl-CoA decarboxylase, Enoyl-CoA hydratase domain-containing protein 1, Methylmalonyl-CoA decarboxylase) (MaxLight 405) discontinued
034904-ML405 100 µL

ECHDC1, CT (ECHDC1, Ethylmalonyl-CoA decarboxylase, Enoyl-CoA hydratase domain-containing protein 1, Methylmalonyl-CoA decarboxylase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Ethyl 4,6- (4-methoxybenzylidene) -β-D-thiogalactopyranoside
TSW-00572-01 100 mg

Ethyl 4,6- (4-methoxybenzylidene) -β-D-thiogalactopyranoside

Sign In for Pricing
View Details
Ethyl 4,6- (4-methoxybenzylidene) -β-D-thiogalactopyranoside
TSW-00572-02 250 mg

Ethyl 4,6- (4-methoxybenzylidene) -β-D-thiogalactopyranoside

Sign In for Pricing
View Details