Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative ethidium bromide resistance protein (ebr)

This Recombinant Putative ethidium bromide resistance protein (ebr) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Putative ethidium bromide resistance protein, E1 protein

UniProt

P0AA22

Expression Region

1-115

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP3 (Sp3 Transcription Factor, DKFZp686O1631, SPR-2) (MaxLight 405) discontinued
252015-ML405 100 µL

SP3 (Sp3 Transcription Factor, DKFZp686O1631, SPR-2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CLIC4 Recombinant Antibody, PE-Cy7 Conjugated
bsm-62733R-PE-Cy7-TR 20 µL

CLIC4 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) YBIX Polyclonal Antibody
MBS7175736 Inquire

Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) YBIX Polyclonal Antibody

Sign In for Pricing
View Details
STARD3NL AAV Vector (Rat) (CMV)
45687106 1 µg

STARD3NL AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Recombinant Clostridium Tetani acpS Protein (aa 1-126)
VAng-Lsx01511-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Tetani acpS Protein (aa 1-126)

Sign In for Pricing
View Details
Ell AAV siRNA Pooled Vector
19216164 1.0 µg

Ell AAV siRNA Pooled Vector

Sign In for Pricing
View Details