Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)
This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.
Product Specifications
Product Name Alternative
Protein CrcB homolog 2
UniProt
Q6GFR9
Expression Region
1-117
Origin
Staphylococcus aureus (strain MRSA252)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MISIILVMIGGGLGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2224-500 1x 500 µL
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), 0.2mg/mL
Sign In for Pricing
View Details 
TRC-P336385-2.5MG 2.5 mg
L-Argininamide-D-phenylalanyl-L-2-piperidinecarbonyl-N-(4-nitrophenyl) Acetic Acid (D-PHE-PIP-ARG-PNA)
Sign In for Pricing
View Details