Recombinant Bacillus subtilis UPF0344 protein yisL (yisL)
This Recombinant Bacillus subtilis UPF0344 protein yisL (yisL) spans the amino acid sequence from region 1-118.
Product Specifications
Product Name Alternative
UPF0344 protein yisL
UniProt
O06725
Expression Region
1-118
Origin
Bacillus subtilis (strain 168)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTHLHITTWVVALILLFVSYSLYSSGSAKGAKITHMILRLFYILIILTGAELFVRFANWN GEYAGKMILGIITIGLMEMLLIRKKKEKSTGGLWVGFVIVLLLTVLLGLHLPIGFQLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15316187 1 Vial
Lentiviral human NFATC2IP shRNA (UAS) - Lentiviral human NFATC2IP shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details MBS6128184-01 0.1 mL
Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin Kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (FITC)
Sign In for Pricing
View Details MBS6128184-02 5x 0.1 mL
Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin Kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (FITC)
Sign In for Pricing
View Details 