Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0344 protein yisL (yisL)

This Recombinant Bacillus subtilis UPF0344 protein yisL (yisL) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

UPF0344 protein yisL

UniProt

O06725

Expression Region

1-118

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHLHITTWVVALILLFVSYSLYSSGSAKGAKITHMILRLFYILIILTGAELFVRFANWN GEYAGKMILGIITIGLMEMLLIRKKKEKSTGGLWVGFVIVLLLTVLLGLHLPIGFQLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SENP1 (Sentrin, SUMO-specific protease 1)
S0725 50 µg

SENP1 (Sentrin, SUMO-specific protease 1)

Sign In for Pricing
View Details
Mouse Monoclonal GCAP2 Antibody (A1) [DyLight 650]
NB120-5422C 0.1 mL

Mouse Monoclonal GCAP2 Antibody (A1) [DyLight 650]

Sign In for Pricing
View Details
Rabbit Anti-DERP6 antibody
SL9638R-01 50 µL

Rabbit Anti-DERP6 antibody

Sign In for Pricing
View Details
Rabbit Anti-DERP6 antibody
SL9638R-02 100 µL

Rabbit Anti-DERP6 antibody

Sign In for Pricing
View Details
PCAF (K (Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (HRP)
249805-HRP 100 µL

PCAF (K (Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (HRP)

Sign In for Pricing
View Details
TAB1 (NM_006116) Human Recombinant Protein
PH38056M5 20 µg

TAB1 (NM_006116) Human Recombinant Protein

Sign In for Pricing
View Details