Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0344 protein yisL (yisL)

This Recombinant Bacillus subtilis UPF0344 protein yisL (yisL) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

UPF0344 protein yisL

UniProt

O06725

Expression Region

1-118

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHLHITTWVVALILLFVSYSLYSSGSAKGAKITHMILRLFYILIILTGAELFVRFANWN GEYAGKMILGIITIGLMEMLLIRKKKEKSTGGLWVGFVIVLLLTVLLGLHLPIGFQLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KBTBD7 Antibody (OTI1G3) [DyLight 755]
NBP2-72268IR 0.1 mL

Mouse Monoclonal KBTBD7 Antibody (OTI1G3) [DyLight 755]

Sign In for Pricing
View Details
NEK4 Human shRNA Lentiviral Particle (Locus ID 6787)
TL320535V 500 µL Each

NEK4 Human shRNA Lentiviral Particle (Locus ID 6787)

Sign In for Pricing
View Details
USP9YP16 Protein Vector (Human) (pPB-C-His)
PV142378 500 ng

USP9YP16 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Ash1l shRNA (UAS) - Lentiviral mouse Ash1l shRNA (UAS, iRFP) (25)
GTR15302897 1 Vial

Lentiviral mouse Ash1l shRNA (UAS) - Lentiviral mouse Ash1l shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
OR11L1, CT (OR11L1, Olfactory receptor 11L1) (FITC)
MBS6328077-01 0.2 mL

OR11L1, CT (OR11L1, Olfactory receptor 11L1) (FITC)

Sign In for Pricing
View Details
OR11L1, CT (OR11L1, Olfactory receptor 11L1) (FITC)
MBS6328077-02 5x 0.2 mL

OR11L1, CT (OR11L1, Olfactory receptor 11L1) (FITC)

Sign In for Pricing
View Details