Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0382 membrane protein SSP2132 (SSP2132)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0382 membrane protein SSP2132 (SSP2132) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

UPF0382 membrane protein SSP2132

UniProt

Q49VD3

Expression Region

1-120

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVFIILGALNAMMAVGTGAFGAHGLENKLSAKYLSVWEKATTYQMYHGLGLLAIGIISG TTSINVNWVGWLLFFGIVFFSGSLYILALTQIRIIGAITPIGGVLFIVGWLMLVIGTFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADRB3 Human Pre-designed siRNA Set A
HY-RS00416 1 Set

ADRB3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Patchouli alcohol
SM5004-100mg 100 mg

Patchouli alcohol

Sign In for Pricing
View Details
C12orf33 Protein Vector (Human) (pPB-His-GST)
PV328551 500 ng

C12orf33 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Goat α2-AP ELISA Kit
EGTA0010 96 Tests

Goat α2-AP ELISA Kit

Sign In for Pricing
View Details
Mouse Gm5622 qPCR Primer Pair
QM75010S 200 Tests

Mouse Gm5622 qPCR Primer Pair

Sign In for Pricing
View Details
RANBP10 Polyclonal Antibody
30156-01 50 µL

RANBP10 Polyclonal Antibody

Sign In for Pricing
View Details