Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1)

This Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q2FXE6

Expression Region

1-121

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLLTALTIAFFSNHPT LKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAVTSYVFGILLCYVGIKLGGGL S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ90680 Human qPCR Primer Pair (NM_207475)
HP219770 200 Reactions

FLJ90680 Human qPCR Primer Pair (NM_207475)

Sign In for Pricing
View Details
6-Azabicyclo[3.2.1]octane Hydrochloride
TRC-S684588-250MG 250 mg

6-Azabicyclo[3.2.1]octane Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB602835 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Thymidylate Synthase (TS106 + TMS715), CF405S conjugate, 0.1mg/mL
BNC040716-500 1x 500 µL

Thymidylate Synthase (TS106 + TMS715), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Aph 1b (APH1B) activation kit by CRISPRa
GA113180 1 Kit

Human Aph 1b (APH1B) activation kit by CRISPRa

Sign In for Pricing
View Details
PLAT Mouse Monoclonal Antibody [Clone ID: OTI3H3]
CF805448 100 µg

PLAT Mouse Monoclonal Antibody [Clone ID: OTI3H3]

Sign In for Pricing
View Details